PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011092151.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 338aa    MW: 38906.8 Da    PI: 6.9916
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011092151.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.7e-092642982155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  XP_011092151.1 264 KWPYPTEEEKNRLSDVTGLEQKQINNWFVNQRKRY 298
                     569*****************************986 PP

2ELK29.31.9e-10218239122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK+ L+rKY+gyL+sL++E++
  XP_011092151.1 218 ELKEVLMRKYRGYLSSLRKELL 239
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-1466110IPR005540KNOX1
PfamPF037901.9E-1767109IPR005540KNOX1
SMARTSM012562.2E-18117168IPR005541KNOX2
PfamPF037915.1E-20121167IPR005541KNOX2
PROSITE profilePS5121310.737218238IPR005539ELK domain
PfamPF037896.5E-8218239IPR005539ELK domain
SMARTSM011881.7E-5218239IPR005539ELK domain
PROSITE profilePS5007112.26238301IPR001356Homeobox domain
SMARTSM003897.8E-10240305IPR001356Homeobox domain
SuperFamilySSF466892.63E-17241311IPR009057Homeodomain-like
CDDcd000861.31E-11242301No hitNo description
Gene3DG3DSA:1.10.10.602.5E-25243303IPR009057Homeodomain-like
PfamPF059201.3E-16258297IPR008422Homeobox KN domain
PROSITE patternPS000270276299IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MDEVYRLDPS ISCPMDSNSA GDDDVHHSVI RVMSGHHNHH TFALATDQTH QGRKGLEMTP  60
LPLVDYTVKA QIANHPLYPY LISAYLDCRK VGAPPEMTSV LEVISKENHP MVSISSTTVG  120
IGTDPELDAF MKWYCEILQK YKEKLSKPYE EATSFLSSIQ SQLTNLCKET LLFNTNTNTN  180
SCPSAPGDGC GRSNEDMRGR THNESRDFSR RRREGDWELK EVLMRKYRGY LSSLRKELLR  240
ERKKGKLPED ARVALLDWWN EHYKWPYPTE EEKNRLSDVT GLEQKQINNW FVNQRKRYWR  300
PIDDSSFSVM DGINGHLNIA GSTYLGETEA LYLNKKHS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092151.10.0PREDICTED: homeobox protein knotted-1-like 1 isoform X1
SwissprotQ9FP297e-79KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLE2CZB51e-108E2CZB5_PETHY; HERMIT-like protein 3
STRINGSolyc01g100510.2.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-71KNOTTED1-like homeobox gene 6